A practical reference on GHRH analog: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-04-30. Anything still debated is marked as such rather than presented as settled.
Stability depends heavily on physical state. A lyophilized powder kept dry, desiccated, and shielded from light typically holds its integrity for months to years at minus twenty degrees Celsius, and longer at minus eighty. Once dissolved, the peptide becomes far more vulnerable, since peptide bond hydrolysis, oxidation of susceptible residues, and aggregation all proceed faster in solution. Buffers near neutral pH are generally gentler than strongly acidic or alkaline conditions. Repeated freeze-thaw cycles and exposure to air-liquid interfaces during vigorous mixing cause losses that are easy to overlook.
Verification matters because research peptides vary widely in quality. A certificate of analysis is only as reliable as the method behind it, and a single chromatographic trace reveals little about counter-ions, residual solvents, or water content. Independent laboratories commonly pair mass confirmation with chromatographic purity and, where relevant, quantify water along with acetate or trifluoroacetate content. Reported purity figures are not standardized across suppliers, so a stated value such as ninety-eight percent is not directly comparable unless the analytical method, column, and detection wavelength accompany it.
Characterization of this peptide relies on a small set of routine techniques. Reversed-phase high-performance liquid chromatography separates the target from truncated or oxidized by-products and yields a purity estimate when paired with ultraviolet detection near 214 nanometers. Mass spectrometry, either electrospray coupled to liquid chromatography or matrix-assisted laser desorption, confirms that the observed mass matches the value calculated for the expected sequence. Amino acid analysis, and enzymatic digestion followed by fragment mapping, are used when the sequence itself rather than the mass requires verification.
Receptor level activity follows the canonical GHRH pathway. The peptide binds the GHRH receptor, a class B G protein coupled receptor on somatotroph cells of the anterior pituitary. Binding raises intracellular cyclic AMP, which promotes calcium entry and the release of growth hormone into the bloodstream. Because the molecule acts at the same receptor as the endogenous hormone, its effect is superimposed on the natural pulsatile rhythm rather than replacing it. Whether sustained receptor occupation leads to desensitization is not fully settled.
CJC-1295 belongs to a class of synthetic peptides modeled on growth hormone releasing hormone, a forty-four amino acid signal produced by the hypothalamus. The compound is built from the first twenty-nine residues of the natural sequence, with four substitutions introduced at positions 2, 8, 15 and 27. These changes were designed to slow enzymatic breakdown while preserving receptor activation. The result is a peptide that is shorter than native GHRH and considerably more resistant to ordinary clearance pathways in circulation.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Assessed by visual inspection under ordinary light |
| Primary analytical method | Reversed-phase liquid chromatography | Purity estimated from peak area at 214 nm |
| Confirmatory method | Mass spectrometry | Observed mass compared with calculated value |
| Powder storage temperature | Minus 20 degrees Celsius | Minus 80 for extended archival periods |
| Solution stability | Hours to days at 2 to 8 degrees Celsius | Influenced by pH, buffer, and concentration |
The core sequence keeps the receptor-binding region of GHRH while replacing four positions that are vulnerable to dipeptidyl peptidase-4 and other proteases. Substitutions at positions 2, 8, 15, and 27 raise metabolic stability relative to the natural hormone. The N-terminal residues remain essential for activity, so changes there generally lower potency. Molecular weight sits near 3368 daltons for the tetrasubstituted analog without the linker, while the albumin-binding form is heavier because of the added maleimide group.
CJC-1295 is a synthetic peptide modeled on growth hormone-releasing hormone, the hypothalamic signal that prompts the pituitary to release growth hormone. Its sequence corresponds to the first twenty-nine residues of human GHRH, with four substitutions that slow enzymatic breakdown. Early descriptions placed the compound in research on growth hormone deficiency and related conditions, and later literature groups it with the long-acting GHRH analogs. The name appears in both laboratory and popular fitness writing, where it sometimes labels chemically different peptides.
Two principal forms appear in the literature and in research supply. One carries a drug affinity complex, a maleimide-based group that forms a covalent bond with circulating albumin. This linkage slows clearance and produces a long-lasting elevation of peptide levels. The other form lacks that group and is often labeled MOD GRF(1-29). It has a much shorter circulation time. Both variants retain the same core receptor-binding sequence. Reported half-lives differ substantially between the two.
At the pituitary, the peptide binds the growth hormone-releasing hormone receptor on somatotroph cells. Receptor activation raises intracellular cyclic AMP and triggers release of stored growth hormone. Somatostatin and other hypothalamic signals modulate this response. Negative feedback from insulin-like growth factor 1 also influences output. The same regulatory architecture operates with the native hormone. Whether the synthetic analog alters feedback dynamics over repeated exposure remains an open question. Most published receptor work uses cell models rather than intact human systems.
CJC-1295 is a synthetic peptide belonging to the growth hormone-releasing hormone analog family. It comprises twenty-nine amino acid residues derived from the N-terminal region of natural GHRH. The molecule incorporates several non-natural substitutions that increase resistance to enzymatic degradation. These modifications extend its activity compared with the native hormone fragment. Researchers use it to study pituitary growth hormone secretion in laboratory and clinical settings. This compound is distinct from native GHRH in its stability profile.
Naming in this area is inconsistent, and readers should treat product labels with care. In much of the literature and in vendor catalogs, the unqualified term refers to the albumin-binding version, while the version lacking the DAC group appears as modified GRF(1-29), mod GRF(1-29), or the same name with a without-DAC qualifier. Because one abbreviation has been applied to both materials, the only reliable way to identify a sample is to check the stated sequence and the presence of the linker.
CJC-1295 is the name used for a synthetic peptide modeled on growth hormone-releasing hormone, the hypothalamic signal that prompts the pituitary to release growth hormone. The compound was described by a Canadian drug discovery company in the mid-2000s as a long-acting research tool. Two closely related molecules share the name in practice: one carries a drug affinity complex, or DAC, group, and one does not. The distinction matters because the two behave differently in circulation.
Two related forms circulate in technical discussion under the same family name. The original version carries a drug affinity complex (DAC) that binds covalently to serum albumin after administration, and this linkage substantially extends circulation time. A second form, frequently written as modified GRF(1-29) or CJC-1295 without DAC, lacks that linker and clears much faster. The naming is a frequent source of confusion because the shorthand CJC-1295 can refer to either form depending on the source. Reports sometimes fail to specify which variant was studied.
The peptide backbone includes a D-alanine at position two, which resists cleavage by dipeptidyl peptidase IV, and several other substitutions that reduce degradation. Its molecular weight is roughly 3.4 kDa without the linker and about 3.6 kDa with it. The molecule is water soluble and is normally supplied as a lyophilized powder. Precise sequence and mass values depend on which variant is described, so technical documents usually state the exact form being referenced.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Retiform hemangioendothelioma (hobnail hemangioendothelioma) Schwannoma (acoustic neuroma, neurilemmoma, neurinoma, neurolemmoma, Schwann cell tumor) Solitary angiokeratoma Solitary cutaneous leiomyoma Solitary mastocytoma Solitary neurofibroma (plexiform neurofibroma, solitary nerve sheath tumor, sporadic neurofibroma) Spider angioma (nevus araneus, spider telangiectasia, spider nevus, vascular spider) Spindle cell hemangioendothelioma (spindle cell hemangioma) Spindle cell lipoma Sternal cleft Subungual exostosis Superficial acral fibromyxoma Systemic mastocytosis Targetoid hemosiderotic hemangioma (hobnail hemangioma) Telangiectasia Telangiectasia macularis eruptiva perstans Teratoma Tufted angioma (acquired tufted angioma, angioblastoma, angioblastoma of Nakagawa, hypertrophic hemangioma, progressive capillary hemangioma, tufted hemangioma) Umbilical granuloma Universal angiomatosis (generalized telangiectasia) Urticaria pigmentosa (childhood type of generalized eruption of cutaneous mastocytosis) Venous lake (phlebectasis) Wildervanck syndrome Xanthelasmoidal mastocytosis Zosteriform metastasis
Less frequently employed treatments encompass prostaglandin pellets inserted into the urethra, the injection of smooth-muscle relaxants and vasodilators directly into the penis, penile implants, the use of penis pumps, and vascular surgery.
=== CaMPARI === Also at the Janelia Research Campus, a new fluorescent molecules known as CaMPARI (calcium-modulated photoactivatable ratiometric integrator) was developed using EosFP. The permanent green to red conversion signal was coupled with a calcium-sensitive protein, calmodulin, so that color change in the fusion construct depended on the release of calcium accompanied by neural activity. CaMPARI is able to permanently mark neurons that are active at an any time and can also be targeted to synapses. This visualization is possible across a wide amount of brain tissue as opposed to the limited view available with using a microscope. It also allows for the visualization of neural activity during complicated behaviors as the organism under study is allowed to move freely, rather than under a microscope. It also allows for the observation of neurons during specific behavior periods. CaMPARI has, thus far, been used to label active neural circuits in mice, zebrafish and fruit flies.
Gas chromatography–vacuum ultraviolet spectroscopy (GC-VUV) is a universal detection technique for gas chromatography. VUV detection provides both qualitative and quantitative spectral information for most gas phase compounds. GC-VUV spectral data is three-dimensional (time, absorbance, wavelength) and specific to chemical structure. Nearly all compounds absorb in the vacuum ultraviolet region of the electromagnetic spectrum with the exception of carrier gases hydrogen, helium, and argon. The high energy, short wavelength VUV photons probe electronic transitions in almost all chemical bonds including ground state to excited state. The result is spectral "fingerprints" that are specific to individual compound structure and can be readily identified by the VUV library. Unique VUV spectra enable closely related compounds such as structural isomers to be clearly differentiated. VUV detectors complement mass spectrometry, which struggles with characterizing constitutional isomers and compounds with low mass quantitation ions. VUV spectra can also be used to deconvolve analyte co-elution, resulting in an accurate quantitative representation of individual analyte contribution to the original response. This characteristically lends itself to significantly reducing GC runtimes through flow rate-enhanced chromatographic compression. VUV spectroscopy follows the simple linear relationship between absorbance and concentration described by the Beer–Lambert Law, resulting in more accurate retention time-based identification.
Sources: en.wikipedia.org
The most expensive process was to preserve the body by dehydration and protect against pests, such as insects. Almost all of the actions Herodotus described served one of these two functions. First, the brain was removed from the cranium through the nose; the gray matter was discarded. Modern mummy excavations have shown that instead of an iron hook inserted through the nose as Herodotus claims, a rod was used to liquefy the brain via the cranium, which then drained out the nose by gravity. The embalmers then rinsed the skull with certain drugs that mostly cleared any residue of brain tissue and also had the effect of killing bacteria. Next, the embalmers made an incision along the flank with a sharp blade fashioned from an Ethiopian stone and removed the contents of the abdomen. Herodotus does not discuss the separate preservation of these organs and their placement either in special jars or back in the cavity, a process that was part of the most expensive embalming, according to archaeological evidence. The abdominal cavity was then rinsed with palm wine and an infusion of crushed, fragrant herbs and spices; the cavity was then filled with spices including myrrh, cassia, and, Herodotus notes, "every other sort of spice except frankincense", also to preserve the person. The body was further dehydrated by placing it in natron, a naturally occurring salt, for 70 days. Herodotus insists that the body did not stay in the natron longer than 70 days.
(1996), the MatrixFillmore Bar (1998), PlumpJack Wines shop Noe Valley branch (1999), PlumpJackSport retail clothing (2000), and a second Balboa Café at Squaw Valley (2000). Newsom's investments included five restaurants and two retail clothing stores. Newsom's annual income was greater than $429,000 from 1996 to 2001. In 2002, his business holdings were valued at more than $6.9 million. Newsom gave a monthly $50 gift certificate to PlumpJack employees whose business ideas failed, because in his view, "There can be no success without failure." Newsom sold his share of his San Francisco businesses when he became mayor in 2004. He maintained his ownership in the PlumpJack companies outside San Francisco, including the PlumpJack Winery in Oakville, California, new PlumpJack-owned Cade Winery in Angwin, California, and the PlumpJack Squaw Valley Inn. He is the president in absentia of Airelle Wines Inc., which is connected to the PlumpJack Winery in Napa County. Newsom earned between $141,000 and $251,000 in 2007 from his business interests. In February 2006, he paid $2,350,000 for his residence in the Russian Hill neighborhood, which he put on the market in April 2009 for $3,000,000. At the time of the Silicon Valley Bank collapse in March 2023, it was acknowledged that at least three of Newsom's wine companies—PlumpJack, Cade, and Odette—were Silicon Valley Bank clients.
Caveolae-associated protein 2 or Cavin-2 is a protein that in humans is encoded by the CAVIN2 gene (previously SDPR). Cavin-2 is highly expressed in a variety of human endothelial cells. This gene has a calcium-independent phospholipid-binding protein whose expression increases in serum-starved cells. This protein has also been shown to be a substrate for protein kinase C (PKC) phosphorylation.
As treasurer, Kennedy sought to refinance portions of Louisiana's debt from Hurricanes Katrina and Rita as interest rates decreased. He worked with the state legislature and several governors' offices to negotiate each refinancing. In 2004, Kennedy told the state legislature that he could save more than $1.4 billion by refinancing the state's debt. He noted that he had sent Governor Kathleen Blanco several letters about refinancing that went unanswered. In 2011, Kennedy announced that Lafayette and Livingston Parishes had saved $11 million by refinancing. By 2013, Kennedy said he had "refinanced virtually all of the state's debt". In 2014, Kennedy worked to refinance $229 million in bond debt. The project faced delays because of a disagreement with Governor Bobby Jindal's office over accounting practices. Jindal's team claimed Kennedy was "unnecessarily holding up" progress on many construction projects, but Kennedy maintained that Jindal's accounting practices potentially violated federal anti-fraud laws. The two sides eventually compromised and the deal moved ahead, saving Louisiana $12 million. By the end of 2014, Kennedy had saved Louisiana a total of more than $600 million by refinancing debt. In 2015, Kennedy saved Louisiana $109 million over 26 years by refinancing a $649 million loan that funded a highway project.
=== Enhanced 25 mm gun === Work on an upgraded weapon began in 1990. In the upgrade program, all three major systems and seven minor systems were improved. The modifications began with introducing a chrome-lined barrel, an enhanced feeder, and an enhanced receiver. The weapon systems also received minor upgrades such as quick-detachable link covers, a larger breech assembly, a high efficiency muzzle brake, longer recoil, an integral round counter, an extended life firing pin and spring, and a triple-spring drive clutch. Upgraded weapons were first put to use on the M2A3 Bradley, the fourth version of the M2 Bradley fighting vehicle.
Sources: en.wikipedia.org
The United Nations Office on Drugs and Crime states, "While medical models of treatment for individuals with alcohol or opioid use disorders are well accepted and implemented worldwide, in most countries there is no parallel, long-term medical model of treatment for individuals with stimulant use disorders." The neglect of stimulant-users has been widely considered to be related to the popularity of stimulants among systemically-oppressed groups, such as methamphetamine use among gay men and transgender people, and crack cocaine use among Black people. The crack epidemic in the United States demonstrates a discrepancy between sentencing lengths of crack cocaine and heroin users, with crack users imprisoned for longer periods of time than heroin users. In 2012, 88% of imprisonments from crack cocaine were of African American people. Stimulant users have increasingly been at risk for opioid overdose since 2006, due to the nonconsensual presence of fentanyl in their substances.
Methemoglobinemia can be treated with supplemental oxygen and methylene blue. Methylene blue is given as a 1% solution (10 mg/ml) 1 to 2 mg/kg administered intravenously slowly over five minutes. Although the response is usually rapid, the dose may be repeated in one hour if the level of methemoglobin is still high one hour after the initial infusion. Methylene blue inhibits monoamine oxidase, and serotonin toxicity can occur if taken with an SSRI (selective serotonin reuptake inhibitor) medicine. Methylene blue restores the iron in hemoglobin to its normal (reduced) oxygen-carrying state. This is achieved by providing an artificial electron acceptor (such as methylene blue or flavin) for NADPH methemoglobin reductase (RBCs usually don't have one; the presence of methylene blue allows the enzyme to function at 5× normal levels). The NADPH is generated via the hexose monophosphate shunt. Genetically induced chronic low-level methemoglobinemia may be treated with oral methylene blue daily. Also, vitamin C can occasionally reduce cyanosis associated with chronic methemoglobinemia, and may be helpful in settings in which methylene blue is unavailable or contraindicated (e.g., in an individual with G6PD deficiency). Diaphorase (cytochrome b5 reductase) normally contributes only a small percentage of the red blood cell's reducing capacity, but can be pharmacologically activated by exogenous cofactors (such as methylene blue) to five times its normal level of activity.
Simon arrives home to find the package delivered. Opening it to find pills, he takes them and ends up in a location from the team's previous game, Afraid of Monsters. At the end, he is hit by a car driven by the Afraid of Monsters protagonist, David Leatherhoff, then revealed to be the one who hit Simon before the game. David, who still uses a lower-quality model and talks entirely in text, apologizes to Simon, admits to being stoned, and flees the scene as Simon angrily yells for him to come back.
Corticotropin-releasing hormone receptor 2 (CRHR2) is a protein, also known by the IUPHAR-recommended name CRF2, that is encoded by the CRHR2 gene and occurs on the surfaces of some mammalian cells. CRF2 receptors are type 2 G protein-coupled receptors for corticotropin-releasing hormone (CRH) that are resident in the plasma membranes of hormone-sensitive cells. CRH, a peptide of 41 amino acids synthesized in the hypothalamus, is the principal neuroregulator of the hypothalamic-pituitary-adrenal axis, signaling via guanine nucleotide-binding proteins (G proteins) and downstream effectors such as adenylate cyclase. The CRF2 receptor is a multi-pass membrane protein with a transmembrane domain composed of seven helices arranged in a V-shape. CRF2 receptors are activated by two structurally similar peptides, urocortin II, and urocortin III, as well as CRH.
Sources: en.wikipedia.org
Mass spectrometry establishes whether the observed molecular weight matches the calculated sequence mass. Chromatographic retention and fragment mapping add further confidence about sequence and composition. A single technique alone is rarely treated as sufficient evidence of identity.
Dry powder is markedly more stable than solution and is usually held frozen and desiccated. Room temperature exposure over days degrades it more slowly than most people assume, but long-term integrity favors freezer storage. Light protection is recommended regardless of temperature.
Methods, columns, gradients, and detection wavelengths are not standardized across laboratories. Some figures describe only the main peak area at one wavelength and ignore water, salts, or counter-ions. Without stated conditions, comparing reported percentages across sources is unreliable.
The names are often used interchangeably in casual writing, but they are not strictly identical. Modified GRF(1-29) refers to the unconjugated analogue carrying only the four substitutions. The version sold as CJC-1295 with DAC includes the albumin binding linker and clears much more slowly.